Resources » Reference Databases » Citations Database
Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis> | To determine optimal conditions for forming cell-permeable peptide-siRNA complexes, EGFP or Chi3l1 siRNA (Bioneer) was mixed with dNP2-HA2 peptide (<b>Genscript</b>, KIKKVKKKGRKGSKIKKVKKKGRKGLFGAIAGFIENGWEGMIDG) which is a combined sequence of a cellpenetrating peptide | Get A Quote |
Chitinase-3-like-1 (Chi3l1) is known to play a significant role in the pathogenesis of Type 2 inflammation and cancer. However, the function of Chi3l1 in T cell and its clinical implications are largely unknown. Here we show that Chi3l1 expression was increased in activated T cells, especially in Th2 cells. In addition, Chi3l1-deficient T cells are hyper-responsive to TcR stimulation and are prone to differentiating into Th1 cells. Chi3l1-deficient Th1 cells show increased expression of anti-tumor immunity genes and decreased Th1 negative regulators. Deletion of Chi3l1 in T cells in mice show reduced melanoma lung metastasis with increased IFNγ and TNFα-producing T cells in the lung. Furthermore, silencing of... More