IVD Raw Materials
Resources » Reference Databases » Citations Database
| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | … 32 The osteopontin blocking peptide covering the ab181440 antigen epitope LLAPQNAVSSEEKDDFKQETLPSNSNESHDHM (amino acids 53–84 in mouse osteopontin) was synthesized with a purity of 945% by Genscript Corp Gene Expression Analysis … | Get A Quote |
Background Pressure overload of the heart occurs in patients with hypertension or valvular stenosis and induces cardiac fibrosis because of excessive production of extracellular matrix by activated cardiac fibroblasts. This initially provides essential mechanical support to the heart, but eventually compromises function. Osteopontin is associated with fibrosis; however, the underlying signaling mechanisms are not well understood. Herein, we examine the effect of thrombin-cleaved osteopontin on fibrosis in the heart and explore the role of syndecan-4 in regulating cleavage of osteopontin. Methods and Results Osteopontin was upregulated and cleaved by thrombin in the pressure-overloaded heart of mice subjected to... More